SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_022106826.1.58406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_022106826.1.58406
Domain Number 1 Region: 134-213
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000108
Family DEATH domain, DD 0.009
Further Details:      
 
Domain Number 2 Region: 26-107
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000262
Family DEATH domain, DD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_022106826.1.58406
Sequence length 218
Comment uncharacterized protein LOC110987957 isoform X4 [Acanthaster planci]; AA=GCF_001949145.1; RF=representative genome; TAX=133434; STAX=133434; NAME=Acanthaster planci; AL=Scaffold; RT=Major
Sequence
MADWDGGESQRRLGRHHEATGPLDDDSLYSISTQIHAGEWRGLATRLGFSAAEVSHFPSD
HSFTAEQINQMLVTWRNRQPVHVNQTEALCKALKEVGNAQLADNLTENQPSACKQPTTQR
AVLCSQTPGELDDSSLYDIAEQIDANEWTRLAAKLGFNQARVSHFKDNHSSVVDQINGML
VAWRKKQPGDVNQREALCKALREVGDINLADKLSVMVQ
Download sequence
Identical sequences XP_022106826.1.58406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]