SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_308398.3.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_308398.3.40869
Domain Number 1 Region: 509-671
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 6.02e-69
Family A middle domain of Talin 1 0.0000171
Further Details:      
 
Domain Number 2 Region: 678-801
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.76e-52
Family I/LWEQ domain 0.0000443
Further Details:      
 
Domain Number 3 Region: 2306-2495
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.46e-51
Family I/LWEQ domain 0.00016
Further Details:      
 
Domain Number 4 Region: 771-906
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.08e-47
Family I/LWEQ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1854-1984
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.2e-32
Family VBS domain 0.00046
Further Details:      
 
Domain Number 6 Region: 1235-1371
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.88e-31
Family alpha-catenin/vinculin 0.062
Further Details:      
 
Domain Number 7 Region: 205-319
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-31
Family Second domain of FERM 0.00000619
Further Details:      
 
Domain Number 8 Region: 320-410
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-25
Family Third domain of FERM 0.0000474
Further Details:      
 
Domain Number 9 Region: 1479-1562
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000144
Family I/LWEQ domain 0.01
Further Details:      
 
Domain Number 10 Region: 2021-2144
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000173
Family VBS domain 0.034
Further Details:      
 
Domain Number 11 Region: 1596-1667
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000188
Family VBS domain 0.044
Further Details:      
 
Domain Number 12 Region: 963-1060
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000863
Family I/LWEQ domain 0.0047
Further Details:      
 
Weak hits

Sequence:  XP_308398.3.40869
Domain Number - Region: 1705-1818
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000377
Family alpha-catenin/vinculin 0.067
Further Details:      
 
Domain Number - Region: 82-141
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000471
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_308398.3.40869
Sequence length 2717
Comment AGAP007474-PA [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
MSTLSLRISLEGGRVTKTIQFDPSTTVFDACRIIKDKFAEAVQGQAQEFGLFLADDDTRQ
GVWLEPARNLGYYMLHNHDVLEYRQKHRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDPEAQNENQPDNRSNTGTLTLRRKAQEKERDAKMESLRKKLRTDDE
INWVDVGKTLREQGIDEQETVLLRRKFFYSDQNIDSRDPVQLNLLYVQARDAILDGTHPV
TQDKACEFAGIQVQIQFGDHNEAKHRPGFLDLREFLPASYVRTKNIERKIFAEHRKHVGL
SDLDAKYEYTKTARELPTYGVTFFLVKEKMTGKNKLVPRLLGVTKDSVLRLDETTKEILK
SWPLTTVRRWGASPNTFTLDFGDYADSYYSVQTTEAEQIVQLIAGYIDIILKKKQAKDHF
GIEGDEGSTMVEESVAPSKATFLQHEETNKGGKVETHSIAKPAIMRGTDGERSYGTGEMQ
SIQYGAIVGQVNLAHQPPMLQQTRISSVLSEPQRALLGYISAGQDALNRAEKDLESKVQL
PPLGTDPGSLQWREETLDTSKQTVTTHLATMNAATAQVVTASQPDEIDHEAVGAAVSQIT
QSIPEVTKEVRLIAALMDDDCTGDKLLEATRKLCNAFSDLLRSAEPESKEPRQNLLNAAT
RVGEASGQVLSTIGEESVESRELHDMLLGLAKAVANTTAALVLKAKSIAAVTEDEATRNK
VIGAASQCALATSQLVACARVVGPTIQSPACREQLEAAAREVAKAVAHLAEVCNEATDNQ
QLRGDLTAAAKDVSKSLTDLLEHIKLSAREKARRVENENPVDNVLVATDILVSSSDPQEM
IRQAQQLGKATAQLIQSIKGEAESQHDSNMQRKLLEAAKQLADATARMVEAARLCAGNPH
DSGHQEMLRTAAEELRVITTSTANTPAIKRQLIGRLEQCARQAASSATQCITAAQNSLIH
SNDVQTKEILLQDCQAVADQIPRLVAGVKGTHARPDDPNAQLCLIDAAEMFLEPGAQMAG
SARELQPTVMDQAAGQQLGRSSVNLTHAIHDLRLAAHRAREACGGNELDAALEAVRNLRS
VLSDTRRAAQEGSLRPLPGETADSCFKQLAAASNAVDVSMHQLMSAAQQGNRTYAGVAGR
DTALALGDYTKSVRGVLVTTKNPAVVDCADEVIVDSLRVIEEAQRTLQNLDNQEALLIAI
KRTKHSLGRTIDCLPGVKDINEAFETVTDLRSILDTGEYPPSDRPYGQLQNELKSAADQL
NVAGGQVAQSYDSSIKLAGTSQEFCHAYKELLTVTLEMAGQTAEDRAREEIVNSLRGVSN
QSISLLGTARYVAGDPDRPNAKNELSSAARLVTESINRLVDVCTQAAPGQKECDGAIRSI
ESLRPLLESPQESLTDQGYFDCLDTVLEKSRTLGEGMTGIANNAKNSKHVEFGHSVNSVS
ESIRGLIESAAQAAYLVGVSNPTSVGGRPGIVDPAQYARAAQAIRQSCDVLRGQASSQPQ
VLSAATVIAKHTSALCNACRNASSTTTNPVAKRHFVQAAKEVANSTAALVREIKALDQDY
SPASRQRCAAATEPLLEAVSSLCHFASSPEFISIPARISTEGRKAQEPILTAGRGILDGA
VDMVRTAKVLALTPTDPPVWQQLATHSRNVSESIKQLASSIREKAPGQMQCDQVLEVLKD
CSRELNSAALAVGVDGLPQRKDSNLQGFTNQSLNAASELIDRLEPVKSSAKKNAESLGHA
VNQIAKHIVPLTNGVIGACSQLVHSGQQTVLINQVKSVVECCAQLVQTAKQAGGNPRAAH
FHPELDEAVESTREAIQELNATVERLSTENGVVTGLMEQISRSMSRISDKRQSFLGASLN
DTYVDYQTRMVQSAKEIARYANEINAKAAIDPSKLAQLCVEMTHHYTQLAQDSIGASALT
TSPDVAIRIRNTVQDLGRSVNVLIQSTTGIRKDDSSGLVEISRGARDVSEKVAQVLAALQ
AGSRGTQACINASSTVSAIISDLDTTIMFATAGTLQSSDEDGKFSDHREHILKTAKALVE
DTKILVAGAAGTQDQLAAAAQNAVTTILQLADAVKHGAASLGSGQPDSQVMVINAVKDVA
AALGELINATKLASGKPINDPAMNDLKDSAKVMVMNVTSLLKTVKAVEDEHTRGTRAMEA
TVDAISQELRSMQFAPEMMRSSMQQLSRPEDLISVTKHVTAATAKAVAAGASNLQADIAA
AANLGRKTISDMLSVCKSVAWSCAETQDLRQRTLDAGSAVAIAYRDLLEGILSHCTADER
MQLSRRVAMCVTDLVGMAQLLKGSDWVDPDDPTVIAENELLGAAASIEAAAKKLANLRPR
RQEVKEADENLNFDEMILEAAKSIMAASSSLVRAANAAQRELIDQGKVAKRPLTSSDDGQ
WSEGLISAARLVAAATHSLVEAAQNLVQGVGTEEMLISSAKQVASSTAQLLIACKVKSDP
NSETGRRLQAAGNAVIKSTDKLVQAAQQAIEGEEEHTLRLNRNMVDGMAQEINARSEILM
RERQLEEAKNKLIAIRHAKYRQKLGGGFTTDESDEGGVAPPPFAGYSQPTSPKPPQTLPK
PGTYSPGSLGASPAQGASTMPRLGQHSPASPSFQRPGSGNQLLTANAVPKPYQSDALKSP
SALVSPSMLNRTYDTTRVENTNLSASKFNRTQFDAAVQDLQNKVQPLSTFRSSPTHTNGG
VAGSSPAPQTYEGFTTR
Download sequence
Identical sequences Q7QJE3
AGAP007474-PA AGAP007474-PA|hypothetical XP_308398.3.40869 7165.AGAP007474-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]