SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_311427.4.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_311427.4.40869
Domain Number 1 Region: 1212-1336
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-18
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_311427.4.40869
Sequence length 1350
Comment AGAP010715-PA, partial [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
FGDFFQNILERAEKRAAALGITNTSKFPLSEFNYEADQQGSAAGASPKKKSGGAAGASPK
KKSVTKKHSAPKPPPPTTTVSTRTATDGERTTTVDIGGQDNCDLALEINITTSANLQVDL
GVKELENDGSVKKQWEHNIVRALEGEKENSAEAKSVIRDQSRNQLQRLGTLYSETQDLSS
PVHRTEGRFHEDVKQSSNKPKPKLAKLAMLADSINNWEDDTSHPDITHHRETIVPGRERK
SPISSSSTRQQSPKRAGEARTGASGSSAPGTGATPKKYPAPNPPKSILTATQKTGSNGGG
EPSSGAAGKPVQTKSLKWDQKVMDTLESQGFQRRESTTSKLVYDYKEDKNGQKTDTYRAP
VTASAVSSTSRERNTTQADQADAVKKSAPVSSSSSQPKKVAVGAPKPAGGLVSGRAAMFE
KSSGRRQSILKPGQKDPAEMSLKERMAIFEKNKGAALVPKAAFGISPSIRQITGQKEGGK
SGSSGSGPMSCAAIQGSGFGSITQQAASSKGVAPASPQSKPKVDHDKAAPKVETKATGSA
IRNTVEALMSDTSTISQSEISEEIRRMRQQEMEMLLNRFTKPADMSSDTIEYETQPIPSA
PPMPPEGYLTGSGRKQSKHSAEGNNVHDGTNDSADVMAALDDVKRIRVGPAAKDGRMYPA
LSDIETTATESGDEGAVGDDYTTATVSGSEGSERAYRTCYGEAEDGERELGDEEEDYDEE
EDNERRHFMYSDDDEEANIANVSLGREILQAVKLNDRRTSRGRRQSQEWNGVSFSLDRSG
ASDGTDPLEDSDLIDACLEEALVDEEEEEEDSEAFDTPRKSSVSSNSFSYQKHSGRDRCA
TINEEESAKDPKSGANKRKSGTPRKSQVGTVDYSSPVRSELQVKPSKDDDDMVTLVHTVS
FYRRQQQQNSMTPRKVPRTPVSTKMAATNSSPRAGTSTSTGTEEGEFLVQEKVKKLLDEV
CKQQTIIAQASQALNLCAATIEFSGSTESAEGERHLLVATHRRQAILDEVQRLRVEGCLR
PPGAPTEKGRLTVKEITLPLKQEYMRKLATDQISGHNLVCLLKYNETVLATQTAPTLPGL
LSVRFPDVLQLSNVFADFKITMEIYGMPASREVLPHEIKYHIALGKKKTGSGSSKLLHTP
KGLKSNSRLIMPPVQSPAGPQAVRSPSLTQYGFIIFSLKEIQRTSWTLNPISGCASPLDG
TVNMRVNCELAVTVDYHGFLTMYEDVSGLGAWHRRWCRLQRHTINYWKYPDDEKRKAPIG
SIDLQGCSTQRVGVAPRDICSRLNTLLLEFPRPARDDDVESLKIVRHGKTTIERYLLSAD
SKEERDEWCAHLNKTLALLKAWGASHVTSC
Download sequence
Identical sequences Q7PRK2
7165.AGAP010715-PA XP_311427.4.40869 AGAP010715-PA AGAP010715-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]