SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_314518.3.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_314518.3.40869
Domain Number 1 Region: 29-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000011
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  XP_314518.3.40869
Domain Number - Region: 324-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_314518.3.40869
Sequence length 377
Comment AGAP010548-PA, partial [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
FCLIQILLRSNSVLFSSDSEDVSLEYETTPTFDVVIAEGKKLKLKVHDYGHRPLCNPVWY
FNGRPVSKSRCIPSYGELVCPSVKREDAGRYDLWGGDGSRHSQARLIFSANVQVTRAVER
DLPEERIAKVQDEPPPFFERKNRVENDCFCSGVTERCRMALDLYRMRKTYDLSNLTAVRL
GGESSGANYIRIPLSVLLGNLITAYGGYMRFPVTEECYTDRSKPCVVMVDKRNMHRAVGY
FLPTSHDQRQVQVLLKESNWKLLPAIDELSDRDSGDELTKFIFMSTLSNIHSVYIRGRYR
TRSEENILSIDMASSYDEGLGTVTTVEECDCHPGYGGLSCERCEKGYLRTYDSISPEGIC
LSIPELWELHKKIYRQN
Download sequence
Identical sequences Q7Q8V0
AGAP010548-PA XP_314518.3.40869 AGAP010548-PA|hypothetical 7165.AGAP010548-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]