SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_314981.2.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_314981.2.40869
Domain Number 1 Region: 151-253
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-23
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 76-136
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-17
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_314981.2.40869
Sequence length 338
Comment AGAP004896-PB, partial [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
IFREFERPAEVNRIQGLRKLLVQHRQEFIYSIVNNTDVQNLDRLLTLELEKYEQVVQDAA
QGGILIDANENFPVAVEKWSMLQAVFFASTVITTIGYGNIVPVTLGGRVFCMLFALIGIP
FTLTVIADWGRLFATAVSILAKNIPDLPLATFTVSRKWLYAVGAVGFLGVYLAAGTGLLL
LWEEDWDFFDGYYFCFITMTTIGFGDLVPSKPNYMLLCTLYILVGLALTSTIIELVRRQY
AQSWQKLQALSGPLAETLRRLGESAGTGIDVTALHNDLRRVLTVVSMPRRHGNKKAQAKE
MAALEAITNAILQDIKEKQNSQEGVPKMVQIVIYESSV
Download sequence
Identical sequences Q7Q822
XP_314981.2.40869 AGAP004896-PB AGAP004896-PB|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]