SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_315695.4.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_315695.4.40869
Domain Number 1 Region: 274-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000723
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 2 Region: 244-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_315695.4.40869
Sequence length 452
Comment AGAP005682-PA [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
MGRKLAHHLVLVGTLLLLAVESFSRAQAAANDYPAQQHQHLRNQQHHQHQHHHRHRTAEP
SRSRNQTSLNYALISGPGSVGNGGSDYRPPYQYPGTTGQQHWGNHHGNQPQHHHRETPPQ
HRRHHRGQAHPSHSQPSSPPGAAGWRRTSGNGGVPAARPVTRMLTRSGTVGSARHNNSTS
GKNVCTVHVYRKSVIKTYQGAPCRDPANCYGLRTYSAPVATREVCCRGWETTTTVADGCF
KPICQTPCRNGGRCTAPDRCTCPAGFTGKYCELDVNECKEHKPCDQTCYNTEGSYYCTCR
DGFMLQSDRQTCKKIGKLGHRGTPGAMEEKYATLNETNDLATEARDMENDLDVDYDSLDI
RLRKLEQLMASRDDRQELTKKVQYTMDAVSVLKSQVARLVSDFVYHFCFYNTELTLFCGS
CFYLSEPTTISTGGLWKSGSLGKPERMERTCF
Download sequence
Identical sequences Q7Q6T5
7165.AGAP005682-PA AGAP005682-PA AGAP005682-PA|hypothetical XP_315695.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]