SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_315949.4.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_315949.4.40869
Domain Number 1 Region: 6-136,193-264
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 2.09e-50
Family Cation efflux protein transmembrane domain-like 0.003
Further Details:      
 
Domain Number 2 Region: 277-343
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.0000275
Family Cation efflux protein cytoplasmic domain-like 0.019
Further Details:      
 
Weak hits

Sequence:  XP_315949.4.40869
Domain Number - Region: 365-393
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0303
Family Blood coagulation inhibitor (disintegrin) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_315949.4.40869
Sequence length 454
Comment AGAP005918-PA [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
MAKFSGKKCRLLTVMTLTVFFFFVEIVVGYLTNSMALVADSFHMLGDIAALVISFLSIKM
SPKKWSKNTFGWARAEVLGALVNAVFLVALCFSITIEACKRFIEVEHIHEPELLIAVGVI
GLLVNLLGLCLLHKHGGGGHIGHSHGGGLSQAKQISGGSHGNLGNTDDNENKSFMYQQNG
TAAKKTTHHGHSHDSSQMNMRGAFLHVLSDALGSVVVIISALIVKFTDWKYKLYMDPALS
VLLVALILNSVWPLLRESALILLQTVPTHIQVDAIQRRLLEKVDGVLAVHEFHVWQLAGD
RIIASAHIRCRNLSEYMKIAERVKEFFHNEGIHSTTIQPEFVEIEALNSYSGSDGFSNSL
NGSATQDCCALDCPTTDESSCIKATCCQNNNNIKPVVVIDKGTAGDTNEPSGSSSAYEGD
QPAGLMMAGGSSATDALLPGSGQNALESEDEAEE
Download sequence
Identical sequences Q7Q6C8
7165.AGAP005918-PA AGAP005918-PA AGAP005918-PA|hypothetical XP_315949.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]