SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_317923.4.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_317923.4.40869
Domain Number 1 Region: 29-89
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-24
Family Calponin-homology domain, CH-domain 0.0000976
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_317923.4.40869
Sequence length 91
Comment AGAP011397-PA [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
MLEDTNESRHPNALHSTNAKFALCGTFSPEHPREKGKMRFHMLQNAQMALDFLRYKKIKL
VNIRAEDIVDGNPKLTLGLIWTIILHFQLIQ
Download sequence
Identical sequences Q7Q2Y6
AGAP011397-PA AGAP011397-PA|hypothetical 7165.AGAP011397-PA XP_317923.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]