SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_414455.4.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_414455.4.86415
Domain Number 1 Region: 43-542
Classification Level Classification E-value
Superfamily Sema domain 1.96e-100
Family Sema domain 0.0009
Further Details:      
 
Domain Number 2 Region: 1413-1538,1704-1861
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.49e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 976-1066
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000178
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.059
Further Details:      
 
Domain Number 4 Region: 886-966
Classification Level Classification E-value
Superfamily E set domains 0.000000000000395
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 5 Region: 545-597
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000109
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1065-1149
Classification Level Classification E-value
Superfamily E set domains 0.000000000484
Family E-set domains of sugar-utilizing enzymes 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_414455.4.86415
Sequence length 1928
Comment PREDICTED: plexin-D1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MGAGTGMDPPASAEPQPLALLPLLPLLLLLLLLPGRAAGLEVQRKFLSPTPTNNFALDGP
GSRVYLAAVNRLFQLSGGELALQAEAAVGPVLDSPLCHAPQLPQASCEHPKVLTNNYNKI
LQPDPEQGVLVVCGSIYQGLCQLRSMANISAVAVRFPPGGSDPLAVFPSMLNVAANHPNA
STVGLLLHRGGGGGGGARLLVAATYTGFGSPFFPRNSSLEDHRFENTPEIAIRALNARGD
LAKLFTFDINPSDDNIFKIKQGAKARHKLSFVRAFLQRARRPYAYLALNSEANAADKESP
SHSLLARICLGDAAEATLNGSGEPKKLTESYIQLGLRCGGAADAFTRLVSVFPARAAWGG
PAEEELLFGVFERAGAGGGRPHSALCIFRFAEIEETIRAARNSCFVSPAAGMVTVLDSVV
QGTGPACEKRNIQLQPEQLDCGAAHLQHPLAIVNPITATPVFTYNGLTAVAVASINNYTV
VFLGTASGGLLKINLDTAMRVVSRRSISVAYGEPVHPVMQFDPSDPTYLYLMTSYQMTRV
KVAACEQYSTCVECLAAADAYCGWCTMETRCSLQHECMNFTEANFWASASEGVQQCPSMT
ILEPEINIDKENPVLIIQINGTIPNLNGTNISCDYGNNIHTVARVAGDYANQFIYCSLLP
RQKYPAFPENQDHVTVETALRVNNKNIIQANFTIYDCKRTGNIYPKRACTSCLSTKWKCY
WCPSRYMCVSNHSWCEDALQMRKKIDCPQIVPAPLDPMPTGTSQDITITLANAIFSEETA
LECHFGMERMFEARWVNSSTVECVHVLLHTSEKSHLFPINLQLKDRPDRFIDSPEMMTVE
VYNCATGSADCSQCLGREDLGHRCVWSESSSSCRQSTESSPPSDVCPAPEIKKIEPLRGP
LEGGTLLTIRGRNLGRRFSDIHGAIRIGSVPCMPLPDRYVVSEAIVCQTGAAQEVFADVV
TVNVSREGKSRERYSYVLPMVHSIAPQNGPKAGGTRVTIRGSWLDVGSELRVLVNSSKQC
TDLSRNDSTITCTMPPAELTTAVRVCIQFESRSCASYNITFKYEKNPIVTDINPKKSQIS
GGRIITLEGRGFELVQNASMVVRAIGREQTSCKVHTDTVITCPSPAASNITAGSKPAPVD
FYLNGRLYTDDRPALDEEMYPEEALHISKFSLEYYADPQFFTAKKEKWIKHHPGEPLTLV
IHKEPDNLGLESSEYQVKIGLISCEIQIVSDKVIHCSVNESLSTSERQLPVTIQVGKFNY
TIAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQI
REEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEECYVLPSQQL
NSQVGSQVQETHPLLVGEWKIPESCRPNMEEGISLFSTLLNNKHFLIVFVHALEQQKDFA
VRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNW
MSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRN
LNVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPRVEDVDLEWFATSTDS
YILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLSDKKDGTLSRVKDLDTEKYFHLV
LPTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIRDDKPPVAV
KYFFDFLEEQAEKRGITDPDTMHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSV
IAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHL
AEESRKYRNEFNTNVAMAEIYKYAKRYRSQIVAALDSNPTTKRTQLQHKFEQVIALMEDN
IYECCSEA
Download sequence
Identical sequences F1P2X8
XP_414455.4.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]