SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_417032.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_417032.1.86415
Domain Number 1 Region: 62-203
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-32
Family C-type lectin domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_417032.1.86415
Sequence length 211
Comment PREDICTED: snaclec coagulation factor IX-binding protein subunit A [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MTHLFLFLLFGALALSGSEGAGNSTARHRNARFLFDFFGRLNPEHNIIPNPSQQDSSARQ
ICRSRCQKGWISYKDHCYMLIQERMTWLEAEKTCSAKSAGGHLTSITSAEQNEFLRKLSQ
GQQNTQFWTGGTYLKGSSLKWSDGSLITFVQRPLSSIFHAVGGLINSLLNIKLCLMVNIG
GGAQWDSSPCGQKLPFICTYKPSLVQLSLNH
Download sequence
Identical sequences A0A1L1RV99
9031.ENSGALP00000027362 XP_417032.1.86415 ENSGALP00000027362 ENSGALP00000027362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]