SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_417878.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_417878.1.86415
Domain Number - Region: 39-160
Classification Level Classification E-value
Superfamily E set domains 0.000532
Family Arrestin/Vps26-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_417878.1.86415
Sequence length 336
Comment PREDICTED: vacuolar protein sorting-associated protein 26B [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MSFFGFGQSAEVELVLSDAESRRRVEHKTEEGKKEKYFLFYDGETVSGRVILTLKHPNRR
LEHQGIKVEFIGQIELYYDRGNHHEFVSLVKDLARPGEFTQSQIFDFEFTHVEKPYESYT
GQNVKLRYFLRATVSRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTSSHTEAKTPSQPAENNGRQ
Download sequence
Identical sequences F1NPH4 G1MS48
ENSMGAP00000001087 XP_003212753.1.16129 XP_021231648.1.32913 XP_417878.1.86415 ENSGALP00000002310 ENSMGAP00000001087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]