SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_418617.3.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_418617.3.86415
Domain Number 1 Region: 346-483
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-42
Family C-type lectin domain 0.00032
Further Details:      
 
Domain Number 2 Region: 787-919
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-38
Family C-type lectin domain 0.00041
Further Details:      
 
Domain Number 3 Region: 924-1079
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-37
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 4 Region: 494-626
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-34
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 5 Region: 161-340
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-34
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 6 Region: 1218-1355
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-33
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 7 Region: 1091-1214
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-30
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 8 Region: 635-778
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-29
Family C-type lectin domain 0.0000991
Further Details:      
 
Domain Number 9 Region: 21-152
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.17e-28
Family Cysteine rich domain 0.0000968
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_418617.3.86415
Sequence length 1415
Comment PREDICTED: macrophage mannose receptor 1-like [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MRFYGFWFVLTLIHGALQLEDTEIFLIYNKVSKLCLQASIAQSVRTATCHQDNESQKFTW
ITDHQLMSVRLNLCLGVPLKEDEVAITLFPCNQTSELQWWECRNESLLAIQGEDLFFSPG
KEEHDNVVLKRLSPKNNWKIYGAMDVLCSQRYEETFTLLGNAFGAPCVFPFMYKKQWYAE
CTTAGRSDGWLWCATTADYDTDQRYGFCPLKDRDTTWTTDVLRNAHYQINSESALTWHQA
RKSCQQQNAELLSITDIHEQTYLKELTESTDSALWIGLNRLDLKSGWEWIGGTPFQYLNW
APGSPSPESGKLCVVLNPETKAKWQNWECDQKLGYICKKRNFTLIPSGDIWPIACPDGWV
SYVDHCYKIFRETKGWQEALTSCQNAGSHLASIQNFEEHSFIVSGLGYKPTDKLWIGLND
HKFQMFFEWSDGTPVTYTKWHLGEPSSTNNRPEDCVMIKGQDGYFADSNCEKKAGYVCKR
KPIPQIPREKENTDVGCKKGWGRYGTYCYFIGHVPATFSEANNTCKGEKGYLATVESRYE
QAYLTSLVGLRPERYFWLGLSDMEDQGTFRWSSGEDVSFTHWGAAIPGSKPGCVAMRTGT
AAGLWDVLDCESKQKYICKQWAVGATAPPISTTAPKPTCPTGWISNDDATSCYKYFCRSD
IKKKSWIEARDFCRQIGGDLATINNEEEKKMISRGNSHCRFERVWLGIFSLNPDEGFAWS
DGSPVRYTGWSDHPRSSGGHMFCGVIDGRTFSGQWLLLPCEEQHDWVCQIKKGVMPKPEP
IDTYEYKTTADGWFIYKDKLYYISKEQVSMEEAQEFCRMNSADLAVISSNSERRFIQRAL
IKNDKYRTESEQYFIGLKISLDKTFSWIDGTPVTYVAWAPNEPNFANNEEHCVVMFSKQG
LWNDVNCGTTNRFVCERHNNSINSTLPSPFPPGGCPESWLFFNNKCFKIFASNTTRKLAW
HDAREVCIDLGGNLASVANEHVQAFVYYHLKDATTNVWIGMNDINRESTFLWADGSTVSY
TNWVEGAPETKQSFFNFYEYELLEDNTVETDCVFMTKSDGKWRDDSCDNERGYICQMNSF
TAQFNLPATNPSSDFVHYGDSSYLIVSSKMQWEEARKNCQEQRAELASILDAYVHSFLWI
QMQKYGKPVWIGLNSNITRSYYKWTDNWKTRFTKWAAEEPKKKNACVYLDLDGTWKTAPC
KEMYFSVCKKTNVVAPTEPAQLPGECPEAADLQAWIPYHGHCYYIEASAATSWAQASLKC
THLGATLVSVENVDESDFLIHTTQLLGNKVGGFWIGLYRNVDDQWLWLDNAVMDFVNWEE
KESDEKHHCVEMTAPSGYWDNTDCSSEKGFICKKPKVEPSGSPLLQKDKQRNEDTHPPVH
PSVWPLFFLAILSLLGAGVLIYIYKRKRQNQLLRD
Download sequence
Identical sequences E1BZ32
ENSGALP00000014043 XP_418617.3.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]