SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_418822.3.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_418822.3.86415
Domain Number 1 Region: 27-143
Classification Level Classification E-value
Superfamily C-type lectin-like 4.19e-16
Family Link domain 0.018
Further Details:      
 
Domain Number 2 Region: 133-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000445
Family Complement control module/SCR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_418822.3.86415
Sequence length 618
Comment PREDICTED: sushi domain-containing protein 5 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MALGSRRSSLTFARAVGPVFFILQIISVRADGKVFALQSKNNSQGLDLAEAEKACVDLSA
RLATAEELKRAVLDCSFIGCTTGWLADGTAGTIICRKTGSKQQSVKAIDVKIETDPFVND
QYDAFCVKDEDKPCGDPPSFPHTILHGHTGFEMGDELLYVCAQGYVMGNKETAFTLLCDS
CGEWYGQVQACVKDETEAHIDYEDNFPDDRSIPIAENEHANGKEEIEQEQLSFSKKSEEG
RTGSTKGVTQDIDTSEKGSRAPTESPVSLLSQKNLFWFPSEAFSEPESEKGTDDSTKAHF
SEGDNHIGVKTVYDEPGAKMFYDSEDFPIGPILTANDTKEEIDAVPITDESWLDGYPVTQ
EVVEDDEEEGDKVDGSMGTEEDIILTTDQPNHVEVRKLGDGSPAPEEGLTQIVAATTSID
DERVKETPVPLTSVSGLEDLSVSRGYDDAAWDHPTTALETVTQEPVTTVLLDITSLRTSV
SETSVMASPFDHTTEEEAKGTTAYPAQVATTAPAPDIPTDTSSPELDEQENLTQGLGEKP
VPTSEPCEGEDCPRSSKGAVIAVIVILLCLLLAAAVLAVWFFKKRQQKNSVYKLNGRCQP
RHHCYHHYHHQHIEMQKV
Download sequence
Identical sequences A0A1D5PQR8
XP_418822.3.86415 ENSGALP00000019506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]