SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_419104.3.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_419104.3.86415
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-32
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 2 Region: 170-292
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-18
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_419104.3.86415
Sequence length 533
Comment PREDICTED: neuropilin and tolloid-like protein 1 isoform X1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MTHGRSFLHIVASLIILHLSGATKKGTEKQTTAEGQKPVQCGTWTKYAEGGIFTSPNYPN
KYPPDRECVYIIEAAPRQCIELHFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPMIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPVCEFEMGGPE
GIVESVQIVKEGKASETEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRSSRFQMLFTSFQEPPCEANTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKANLLDQLTNTSGTIIGVTSCIVIILIVIS
VIVQIKQPRKKFVQRKTDFDQTVFQEVFEPPHYELCTLRGTGTTADLADVADDFENYHKL
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASVLTEIQPQPVKPLIQPVNRRNILVMKH
SYSQDAADTCEIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences ENSGALP00000022274 XP_015137918.1.86415 XP_419104.3.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]