SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_420385.2.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_420385.2.86415
Domain Number 1 Region: 106-390
Classification Level Classification E-value
Superfamily L domain-like 1.79e-49
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 2 Region: 246-259,412-713
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.39e-45
Family Rhodopsin-like 0.00069
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_420385.2.86415
Sequence length 763
Comment PREDICTED: relaxin receptor 1 isoform X1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MTSDWCFYIFLLIGTKVIRDSLEDPVSRGGAACPLGYFPCGNITKCLPQQLHCNGEDDCG
NHADEDNCEDNNGWSLQFDKHYTLDKMKSLYAFQTKTPECLAGAVPVECKCQGLEVFCDA
AKLRDVPLVPSNITTMSLQKNLLRKLYADVFRKYQDLKNLYLQDNKIRAVSKHAFKGLYN
LTKLYLSNNKITNLKPRVFEDLHKLEWLIIENNRINRISPSTFYGLKSLILLDMMNNSLA
HLPDKPLCQYMPRLNWLDLEGNHIHHLRNVTFISCSTLTVLVMRQNKISSLNENSFSSLQ
MLDELDLASNEIESLPAYVFKDLKELSQLNLSYNPIKKIQIDQFDFLTKLKSLSLEGIEI
ANIQRRMFIPLRNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVV
SAITCFGNIFVICMRPYIRSENKLHAISIMSLCCADCLMGIYLFVIGAFDLKYRGEYNKH
AQLWMDSIHCQLVGSLAILSTEVSVLLLTYLTLEKYICIVYPFRCLKPRKCRTISILVLI
WVIGFAVAFIPLSNKEFFRNYYGTNGVCFPLHSEQSESSGSQIYSVVIFLGVNLAAFLII
VFSYGSMFYSVHQTAIMATEIQNHIKKEMILAKRFFFIVFTDALCWIPIFILKLLSLLQV
EIPGTITSWVVIFILPINSALNPLLYTLTTRPFKEMIHQFWYNYRQRRSKRGKGSQKAYG
PSFIWVEMWPMHEITPKLTKPVLCTDSSDASVTTQSTRLNSYT
Download sequence
Identical sequences F1NY48
XP_420385.2.86415 ENSGALP00000015337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]