SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_421303.2.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_421303.2.86415
Domain Number 1 Region: 357-590
Classification Level Classification E-value
Superfamily HCP-like 5.76e-50
Family HCP-like 0.00013
Further Details:      
 
Domain Number 2 Region: 564-698
Classification Level Classification E-value
Superfamily HCP-like 7.06e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 197-321
Classification Level Classification E-value
Superfamily HCP-like 9.16e-24
Family HCP-like 0.0031
Further Details:      
 
Domain Number 4 Region: 114-169
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_421303.2.86415
Sequence length 791
Comment PREDICTED: protein sel-1 homolog 1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MGWRVRLALLLCVALLWAAGLAAADEEGNQDESLESEALPAEDQVKDRSTGTQVVAGQIF
LESGKSDSQPEDEENLHSQEEEKENSLEELNSLDMSDLLNKDLEDTEMQSPVLTAIGGTA
DGEPCHFPFLFMEKEYAECTADGREDGRLWCATTYDYKKDQKWGFCETEEQSNKRRQMQE
AEDIYQTGMKILNESTKKAQKKEAYQYLLKAADMNHTKAMEKVSYALLFGDYLKQNIQSS
KELFEKLTEEGSPKGQMALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMILGYRYW
AGIGVLQSCESALTHYRLVANHVASDISLTGGTVVQRIRLADEVENPGMASGMLEEDLIQ
YYQFVAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFEYFNQAANAGNSHAMAFLGKMYSE
GSDVVPQNNETALQYFKKAADMGNPVGQSGLGMAYLYGRGVPVNYELALKYFQKAAEQGW
VDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHATGTGVMRSCHTA
VELFKNVCERGRWSERLMTAYNSYKDGDSNSAVVQYLLLAEQGYEVAQSNAAFILDQKEA
SIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQH
SAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVIYAVQYIR
EMNLREVFSHIDMDQLLGPEWDLYLMTIITLLLGTIIAYRQRQHQAIPRPAGLRPAVPQQ
EPPPPEHQPPQ
Download sequence
Identical sequences E1C6X2
9031.ENSGALP00000017201 XP_421303.2.86415 ENSGALP00000017201 ENSGALP00000017201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]