SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_425924.4.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_425924.4.86415
Domain Number 1 Region: 125-372
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-69
Family Nuclear receptor ligand-binding domain 0.00000000318
Further Details:      
 
Domain Number 2 Region: 57-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_425924.4.86415
Sequence length 454
Comment PREDICTED: hepatocyte nuclear factor 4-gamma isoform X1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MMRVSEPILDMEMANYSEVLDPTYTTLEFETMQILYNGNDSSGEPLNMNATDSGISSLCA
ICGDRATGKHYGASSCDGCKGFFRRSIRKNHVYTCRFSRQCVVDKDKRNQCRYCRLKKCF
RAGMKKEAVQNERDRISTRRNTFDGCNIPSISTLSQAEALSRQISVSSPGASTDINAKKI
AGISDVCESMKQQLLVLVEWAKYIPGFCELPLDDQVALLRAHAGEHLLLGAAKRSMAYKD
ILLLGNNYIIHRNSTEVEISRVANRILDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGL
SNPVKIKNMRYQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQLVKLFG
IVKIDSLLQEMLLGGTSNDASHLHHPVHPHLAQDPLTGQTILISSMSAPVHAEQISTPET
PLPSPPQGSGQEYKMSSNQASVIAQQSILKQKSL
Download sequence
Identical sequences A0A1D5PAS5
ENSGALP00000025225 XP_425924.4.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]