SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_455100.1.35115 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_455100.1.35115
Domain Number 1 Region: 256-395
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.2e-50
Family P-domain of calnexin/calreticulin 0.00000555
Further Details:      
 
Domain Number 2 Region: 52-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-36
Family Calnexin/calreticulin 0.0000448
Further Details:      
 
Domain Number 3 Region: 399-443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000823
Family Calnexin/calreticulin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_455100.1.35115
Sequence length 628
Comment hypothetical protein [Kluyveromyces lactis NRRL Y-1140]; AA=GCF_000002515.2; RF=representative genome; TAX=28985; STAX=28985; NAME=Kluyveromyces lactis; strain=NRRL Y-1140; AL=Complete Genome; RT=Major
Sequence
MNPLLLLSQIGFGTLAVAINPMVKGDYRIEHPNMTDLSDLQSKLSSDSYFESFQYSSHDE
FIHNWVISELEMEHVDETMSRAFPGLWKLESPYLVPGFSNDLALVLGSSQTRSAIAHKLD
HEISVKTKEKLVVQYEVKLQKMLECGGAYMKLLKTNADDLSQYDHSADDYVLVFGPDSCS
MYTNEVHFILKRENPISEEFEDKYLTEAPLSGLDQPITRLYTLILDSADQSFEIRIDGEV
VKAGNLLAEGTFRPSLNPPREIEDPSASQPADWGSRSMIPDPTAIKPEDWDENEPKWIPD
PMFKKPEEWDDSISEYIEDESRSKPDWWNDKVDGRWIAPLIVNPSCYTKQGCGKWRPKMV
ENEKYRGTWKAEMIPNPNYQGEWKAPLIANPNYYEDKTPANIDAITAISFDIWSSASDIS
FDNIYVGKSIEEAELVGNSTFLPKLSLEKKELEVVMEKAHSEDVNEVDTSEESSKKTPYK
NVVDKENHLDYLKLIDEKIKSCKTLQTFIAWFLQVDDLYKGFLISAFMVVVVSISCMGML
KFLMWSQGIDLSSSSNASRKPKKIENETSDGPSANTVTEIAASTGYSTPSSKVISQRTIQ
LQGDSDFDEELEISIVEESGSASDSEDK
Download sequence
Identical sequences Q6CLT9
28985.Q6CLT9 XP_455100.1.35115 gnl|GLV|KLLA0F00462g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]