SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_503393.1.88470 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_503393.1.88470
Domain Number 1 Region: 85-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000319
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Weak hits

Sequence:  XP_503393.1.88470
Domain Number - Region: 9-71
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000665
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 
Domain Number - Region: 309-375
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_503393.1.88470
Sequence length 402
Comment YALI0E00924p [Yarrowia lipolytica CLIB122]; AA=GCF_000002525.2; RF=representative genome; TAX=284591; STAX=4952; NAME=Yarrowia lipolytica CLIB122; strain=CLIB122; AL=Chromosome; RT=Major
Sequence
MVKRSHNQLNEDEAHMRFIVASEQAEKLLIKKQQSLRELSKSLCIKIKFSPFINTHTDRV
MSITGTPENIGSTIGSLVRTWTGNNDDSSAQFTIQMIIPEPMVAKIVGFKGYGLRKLHRK
SGAAIEAIKDGLPDSTDRLFTATGVADSLHRAVYFTSLIFQEYTGLLKRFEQESSPYEPR
DNINPLRRRITGTYIPPDSPAHFVSRKKKTAETKHKHTMEVIAGSSPNQPMVVSGSREAV
SSACTKVEDLPQESIETLPCSPPPETEYKLASKRFESPPPSPLLLDTPVKSQKEECILVC
PPSPPLSIDDNVVTKRLMVTCPMVGTMLSLSEELLNLMRQNSGAAIRVKEIVSHEQIQLI
ITGTKSQVSRVMEDLTLTTRNSYLFTKAIEQSECEYLEEQDA
Download sequence
Identical sequences A0A1D8NGN8 Q6C7G9
4952.Q6C7G9 gnl|GLV|YALI0E00924g XP_503393.1.88470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]