SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_507723.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_507723.2.37143
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 2.36e-47
Family C-type lysozyme 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_507723.2.37143
Sequence length 194
Comment PREDICTED: lysozyme-like protein 1 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MQDAHLSCLSPTKWSSVSSADSTEKSASGAGTRNRPFQFCLRQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCE
GRDLSEWKKGCEVS
Download sequence
Identical sequences A0A080YV03
9598.ENSPTRP00000050711 XP_507723.2.37143 ENSPTRP00000050711 ENSPTRP00000050711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]