SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_512503.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_512503.1.37143
Domain Number - Region: 162-206
Classification Level Classification E-value
Superfamily HMG-box 0.000196
Family HMG-box 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_512503.1.37143
Sequence length 223
Comment PREDICTED: coiled-coil domain-containing protein 124 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MPKKFQGENTKSAAARARRAEAKAAADAKKQKELEDAYWKDDDKHVMRKEQRKEEKEKRR
LDQLERKKETQRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLREAPDTAEKA
KSHLEVPLEENVNRRVLEEGSVEARTIEDAIAVLSVAEEAADRHPERRMRAAFTAFEEAQ
LPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQRAVPFNAPK
Download sequence
Identical sequences A0A024R7M8 H2NY22 H2QFS2 Q96CT7
9598.ENSPTRP00000018239 9600.ENSPPYP00000010899 9606.ENSP00000262801 ENSP00000408730 ENSPTRP00000018239 ENSP00000408730 ENSP00000471455 ENSPTRP00000018239 ENSPPYP00000010899 ENSPPYP00000010899 ENSPPYP00000024289 gi|19923969|ref|NP_612451.1| gi|209969700|ref|NP_001129675.1| NP_001129675.1.87134 NP_001129675.1.92137 NP_612451.1.87134 NP_612451.1.92137 XP_002828955.1.23681 XP_003817833.1.60992 XP_512503.1.37143 ENSP00000408730 ENSP00000471455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]