SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_513483.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_513483.2.37143
Domain Number 1 Region: 24-351
Classification Level Classification E-value
Superfamily L domain-like 8.33e-61
Family Leucine rich effector protein YopM 0.071
Further Details:      
 
Domain Number 2 Region: 395-578
Classification Level Classification E-value
Superfamily L domain-like 3.74e-31
Family Ngr ectodomain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_513483.2.37143
Sequence length 602
Comment PREDICTED: leucine-rich repeat-containing protein 40 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MSRLKRIAGQDPRAGFKAGGRDCGTSVPQGLLKAARKSGQLNLSGRNLSEVPQCVWRINV
DIPEEANQNLSFGATERWWEQTDLTKLIISNNKLQSLTDDLRLLPALTVLDIHDNQLTSL
PSAIRELENLQKLNVSHNKLKILPEEITNLRNLKCLYLQHNELTCISEGFEQLSNLEDLD
LSNNHLTTVPASFSSLSSLVRLNLSSNELKSLPAEINRMKRLKHLDCNSNLLETIPPELA
GMESLELLYLRRNKLRFLPEFPSCSLLKELHVGENQIEMLEAEHLKHLNSILVLDLRDNK
LKSVPDEIILLQSLERLDLSNNDISSLPYSLGNLHLKFLALEGNPLRTIRREIISKGTQE
VLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFD
AVKSNIITSINFSKNQLCEIPKRMVELKEMVSDVDLSFNKLSFISLELCVLQKLTFLDLR
NNFLNSLPEEMESLVRLQTINLSFNRFKMLPEVLYRIFTLETILISNNQVGSVDPQKMKM
MENLTTLDLQNNDLLQIPPELGNCVNLRTLLLDGNPFRVPRAAILMKGTAAILEYLRDRI
PT
Download sequence
Identical sequences H2PZ80
9598.ENSPTRP00000001472 XP_513483.2.37143 ENSPTRP00000001472 ENSPTRP00000001472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]