SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_517361.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_517361.2.37143
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-27
Family SH2 domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_517361.2.37143
Sequence length 280
Comment PREDICTED: dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
Download sequence
Identical sequences G3QFN7 H2QPY0 Q9UN19
NP_055210.2.87134 NP_055210.2.92137 XP_003829986.1.60992 XP_004040230.1.27298 XP_517361.2.37143 hsi002011017.1 gi|158631203|ref|NP_055210.2| ENSGGOP00000001114 ENSPTRP00000060568 9598.ENSPTRP00000028016 9606.ENSP00000296414 ENSP00000423602 ENSPTRP00000028016 ENSGGOP00000001114 ENSP00000423602 ENSP00000423602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]