SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_519990.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_519990.2.37143
Domain Number 1 Region: 98-180
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000458
Family Snake venom toxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_519990.2.37143
Sequence length 223
Comment PREDICTED: lymphocyte antigen 6K isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MGLQRPRQAPAGGRRAPRGRRGSPYRPDPGRGARRLRRFQKGGEGASRADPHWASLGTMA
LLALLLVVALPRVWTDANLTARQRDPEDTQQTDEGDNRVWCHVCERENTFECQNPRRCKW
TEPYCVIAAVKIFPRFFVISKQCSAGCAATERPKPEEKWFLLEEPMPFFYLKCCKIRYCN
LEGPPINSSVFKEYAGSMGESCGGLWMAILLLLASIAAGLSLS
Download sequence
Identical sequences XP_519990.2.37143 ENSPTRP00000035287 ENSPTRP00000035287 9598.ENSPTRP00000035287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]