SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_520143.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_520143.2.37143
Domain Number 1 Region: 259-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-52
Family SPRY domain 0.00024
Further Details:      
 
Domain Number 2 Region: 21-79
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000116
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_520143.2.37143
Sequence length 442
Comment PREDICTED: tripartite motif-containing protein 14 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MAGAAAGTRTPGRSELVERCGWRCPEHGDRVAELFCRRCRRCVCALCPVLGAHRGHPVGL
ALEAAVHVQKLSQECLKQLAIKKQQHVDNITQIEDATEKLKANAESSKTWLKGKFTELRL
LLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDVMNDLSNRVWSIGQEPDPVQRLQA
YTATEQEMQQQMSLGELCHPVPLSFEPVKSFFKSLVEAVESILQMPLDIRLKESINCQLS
DPSSTKPGTLLKTSPSPQRSLLLKYARTPTLDPDTMHARLRLSADRLTVRCGLLGSLGPV
PALRFDALWQVLARDCFAAGRHYWEVDVQEAGAGWWVGAAYASLRRRGASAAARLGCNRQ
SWCLKRYDLEYWAFHDGQRSRLRPRDDLDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRAT
FQEPLYPALRLWEGAISIPRLP
Download sequence
Identical sequences H2QXJ9
ENSPTRP00000036183 9598.ENSPTRP00000036183 XP_009455255.1.37143 XP_016816794.1.37143 XP_520143.2.37143 ENSPTRP00000036183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]