SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_522887.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_522887.2.37143
Domain Number 1 Region: 41-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000297
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_522887.2.37143
Sequence length 303
Comment PREDICTED: sushi domain-containing protein 6 isoform X2 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MCHGRIAPKSTSVFAVASMGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPC
RDPLTAGSVIEYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCHLNEDKDTHTSLGVPTLS
IVASTASSVALILLLVVLFVLLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEA
VYGSSGHCVPPADPRVQIVLSEGSGPSGRSVPREQQLPDQGACSSAGGEDEAPGQSGLCE
AWGSRGSETVMVHQATTSSWVAGSGNRQLAHKETADSENSDIQSLLSLTSEEYTDDIPLL
KEA
Download sequence
Identical sequences H2Q8I8
XP_009426299.1.37143 XP_016781756.1.37143 XP_522887.2.37143 ENSPTRP00000010996 9598.ENSPTRP00000010996 ENSPTRP00000010996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]