SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_527497.3.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_527497.3.37143
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000628
Family Hairy Orange domain 0.00013
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_527497.3.37143
Sequence length 337
Comment PREDICTED: hairy/enhancer-of-split related with YRPW motif protein 2 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF
Download sequence
Identical sequences H2QTP5 Q9UBP5
gi|6912414|ref|NP_036391.1| ENSPTRP00000031710 ENSP00000357348 ENSPTRP00000031710 ENSP00000357349 NP_036391.1.87134 NP_036391.1.92137 XP_003827661.1.60992 XP_527497.3.37143 ENSP00000357348 9598.ENSPTRP00000031710 9606.ENSP00000357348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]