SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_533732.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_533732.2.84170
Domain Number 1 Region: 54-550
Classification Level Classification E-value
Superfamily Sema domain 1.12e-100
Family Sema domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1411-1536,1702-1858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-34
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 888-980
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000502
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 4 Region: 979-1069
Classification Level Classification E-value
Superfamily E set domains 0.000000000000385
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.041
Further Details:      
 
Domain Number 5 Region: 1066-1147
Classification Level Classification E-value
Superfamily E set domains 0.00000000000642
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 553-605
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000235
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_533732.2.84170
Sequence length 1926
Comment PREDICTED: plexin-D1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MARRAAGGAPHSARAAAASPPPPRPPRRAPRPCPLLPPLLLLLGAARAGALEVQRRFPSP
TPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEH
PRRLTDNYNKILQLDPGQGLVVACGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVF
PSMLNVAANHPNASTVGLVLPPAAGSGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTP
EIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPEPPPGAPSY
AYLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYS
RLVSVFPARELLFAVFERPQGSPAARATPAALCAFRFADVQAAIRAARNACFVEPAPDVV
AVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLSSVAV
ASVSNYTVVFLGTVSGRLLKINLNESMQVVSRRAVTVAYGEPVHHVMQFDPADPGYLYLM
TSHQMARVKVAACAVHTTCGDCVGAADAYCGWCALETRCTLQQDCANSSQRHFWTSASEG
PSRCPTMTVLPAEIDVHQEYSGMILQISGSLPSLSGMEMACDYGNNIRTVARVPGPAFDH
QIAYCNLLPRDQFPPFPPHQDHVIVEMSVRVNGRNIVRADFTIYNCSRVGQVYPHTACTS
CLSAQWPCFWCAQQHACVSNQSRCEASPNPMNPQDCPQILPSALAPMPTGSSQSIPVHLA
NAAFQGAALECSFGPEEVFEAIWVNESTVHCNQLHTTQKSQVFPLSLQLKGQPARFLDSP
DPMTVEVYNCAMGSPDCSQCLGREDLGHLCVWSDGCRLRGPLQPLPGTCPAPEIRTIEPL
SGPLDGGTLLTIRGRNLGRRLSDVAHGVWVGSVACEPLANRYTVSEEIVCATGPAPGPFS
DVVTVNASKEGKSRERFSYVLPLVQFLEPDKGPKAGGTRIIIHGSDLHVGSELQVLVNDT
EPCTELVRTEASITCTVPEGALPAPVPVCVRFERRGCVRSNLTFQYMQNPVITAISPRRS
PVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDF
FINGRAYADEAAVAEELLDPDEARRGSRFRLDYLPDPQFSTAKREKWIKHHPGEPLTLVI
HKEQDSLGLESHEYRIKIGQVACDIQIVSDRVIHCSVNESLGTAEGQLPITIQVGNFNQT
IATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIR
EEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLN
SQGSCPVQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVR
DRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMS
ICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLN
VSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYI
LRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLP
TDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKY
FFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIA
QAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLAE
ESRKYQNEFNTNVAMAEIYKYAKRYRTQIMTALEANPTARRTQLQHKFEQVVALMEDNIY
ECYSEA
Download sequence
Identical sequences XP_533732.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]