SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_537187.4.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_537187.4.84170
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Serpins 3.27e-137
Family Serpins 0.000000000000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_537187.4.84170
Sequence length 465
Comment PREDICTED: antithrombin-III [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MFSNGIGMIAAGKRRTCLLSLLLIGLWGCVVCPWSPGEDICTAKPRDIPVNPMCIYRSPE
KKAVEDEGAEQKIPEATNRRVWELSRANSRFATAFYQHVADSKNDNDNIFLSPLSISTAF
AMTKLGACNNTLKQLMEVFKFDTISEKTSDQVHFFFAKLNCRLYRKANKSSELVSANRLF
GDKSLTFNETYQDISEAVYGAKLQPLDFKENAEQSRMIINKWVSNKTHGRITDVVPPDAI
DELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKAGGESCSVSMMYQEGKFRYRRVAEGT
QVLELPFKGDDITMVLILPKPEKSLAKVEQELTPEVLQEWLDEMTETLLVVHMPCFRMED
SFSVKERLQDMGLVDLFNPEKSRLPGIVAEGRNDLFVSDAFHKAFLEVNEEGSEAAASTV
IGIAGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCDN
Download sequence
Identical sequences E2RES2
ENSCAFP00000021382 XP_537187.4.84170 ENSCAFP00000021382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]