SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_539966.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_539966.2.84170
Domain Number 1 Region: 140-298
Classification Level Classification E-value
Superfamily PH domain-like 4.28e-33
Family Pleckstrin-homology domain (PH domain) 0.0000496
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-22
Family Pleckstrin-homology domain (PH domain) 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_539966.2.84170
Sequence length 425
Comment PREDICTED: pleckstrin homology domain-containing family A member 2 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTQANCLLWYMDNPQNLAVGAGAVGSLQ
LTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKITVPKVG
SLPLTTEVIKSLAAPPALEKKPQVAYKTEIIGGVVVHTPINQNGGDGQEGSEPGSHAILR
RSQSYIPTTGSRVPSGPPLIKSGYCVKQGNVRKSWKRRFFALDDFTICYFKCEQDREPLR
TIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYIQADSPEDMHSWIKEIGAAVQAL
KCHPRDMSFSRSISLTRSGSSSHSGGPNSFLCRGRPPVEEKKALCKAPSVASSWQPWTPV
PQAGDKLLPAEETPGDSLLMSRLGESSTSGVLPSSRIRHRSEPQHPKEKPFLFSLDDESI
RTSDV
Download sequence
Identical sequences J9NYG3
ENSCAFP00000038332 ENSCAFP00000038332 9615.ENSCAFP00000008781 XP_005629900.1.84170 XP_539966.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]