SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_541301.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_541301.2.84170
Domain Number 1 Region: 842-1119
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-72
Family Protein kinases, catalytic subunit 0.00000423
Further Details:      
 
Domain Number 2 Region: 523-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.6e-49
Family Protein kinases, catalytic subunit 0.0000637
Further Details:      
 
Domain Number 3 Region: 396-501,538-563
Classification Level Classification E-value
Superfamily SH2 domain 2.2e-17
Family SH2 domain 0.0031
Further Details:      
 
Domain Number 4 Region: 279-386
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-16
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 141-261
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000178
Family Second domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_541301.2.84170
Sequence length 1132
Comment PREDICTED: tyrosine-protein kinase JAK2 isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MGMACLTMTEMEGTSESPIHQNGDIPGNANSVKQIDPLLQVYLYHSLEKAEEEYLKFPTG
EYVAEEICVAASKACGITPVYHSMFALMSETERIWYPPNHVFHIDESTKHNVLYRIRFYF
PYWYCNGSNRTYRHGISRGAEAPLLDDFVMAYLFAQWRHDFLHGWIKIPVTHETQEECLG
MAVLDMMRLAKEKDQTPLDIYSSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKRKESETLTEQDLQLYCDFPDIIDVTIKQASQEGSNESRIVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPILMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAIERENVIEYKHCLITKNENGEYNLSGTKKSFRNLKDLLNC
YHMETVRSDSIIFQFTKCCPPKLKDKSNLLVFRTNGVSDVPTSPTLQRHNNVNQMVFHKI
RNEDLMFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINIFWKLEVAKQLAWA
MHFLEEKALIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFPGAFEDQD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYLIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Download sequence
Identical sequences E2RPW6
ENSCAFP00000003097 ENSCAFP00000003097 XP_541301.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]