SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_543874.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_543874.2.84170
Domain Number 1 Region: 672-862
Classification Level Classification E-value
Superfamily Sec7 domain 1.14e-65
Family Sec7 domain 0.00000536
Further Details:      
 
Domain Number 2 Region: 870-1002
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000481
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_543874.2.84170
Sequence length 1203
Comment PREDICTED: IQ motif and SEC7 domain-containing protein 3 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MESLLENPVRAVLYLKELTAIVQNQQSLIHTQRQRIDELERRLDELSAENRSLWEHQQLL
QAQPPPGLVPPSPAPLPAAPAAPATAAAAAAAAAQEPLQNHGQLPPAAPQPAPEQPPLQH
HGQLLVQPQPGPSSRAHAPQSPHQHPVAPGAVADKEKERPPSCCAAAGTLLQHKSPAALG
KGVLTRRPENETVLHQFCCPAADAEQKPACSDSVSQSDGSCAQAGGGMEDSVVAAAAVAA
GRPSAHAPKAQAQELQEEEERPGAGGASPRAGPHRTASPGRQQPALATALCSHAPNASDY
ELSLDLKNKQIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRI
SLRKVRAPAVEGLAAEKALVEGYGLVGLPLVRSPSLPPTLAGTLTELEDSFTEQVQSLAK
SIDDALSTWSLKTMCSLQESGAYQLHQALHAGAAPAGLEAEMRELDGARPAPGEEAAEPA
GLPPGHSSTLMMAFRDVTVQIANQNISVSSATALSVANCLGAQAAPAPAEPAAGRAEQGE
APGREASAAAASADPGAAHAENTCAEAGARGSPRAHPPAEAAVQEAALTEAEAAEAEEEE
TRDVGKGTEAEAGDNSERLSSSSTSTKSAKSGSEVSASASKEALQAMILSLPRYHCENPA
SCKSPTLSTDTLRKRLYRIGLNLFNINPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSR
QMIGEFLGNSKKQFNRDVLDCVVDEMDFSNMELDEALRKFQAHIRVQGEAQKVERLIEAF
SQRYCMCNPEVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDD
GADIPRELVVGIYERIQQKELKSNEDHVTYVTKVEKSIMGMKTVLSMPHRRLVCCSRLFE
VTDVNKLQKQAAHQREVFLFNDLLVILKLCPKKKSSSTYTFCKSVGLLGMQFHLFENEYY
SHGITLVTPLSGSEKKQVLHFCALGSDEMQKFVEDLKESVAEVTELEQIRIEWELEKQQG
AKTLSFKSSGAQVDPQLKQGSPTAKREAALGEKPVESTVEVSIHNRLQSSQHNPALGAER
GAPAPPQDPQPSPLREQPPPLPPPPTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALS
CYASSSSDSCGSTPLGGPGSPVKVIHQPPLPPPPPPYNHPHQYCPPGSLLHRRRYSSGSR
SLV
Download sequence
Identical sequences E2QWT6
ENSCAFP00000023159 ENSCAFP00000023159 XP_543874.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]