SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_545613.3.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_545613.3.84170
Domain Number 1 Region: 112-236
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000000000116
Family Cyclin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_545613.3.84170
Sequence length 312
Comment PREDICTED: cyclin-Y-like protein 1 isoform X3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MGNTLTCCVSSNASPKLGRGTGPADPDYESDVYQAAAGDAVAVAPAPATVEPAELDFGAG
EGHHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHCDLSNILP
HKEQREKVPEEYFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICP
TNWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPSS
VYAKYYFDLRSLADDNNVNFLFAPLSKERAQNLEAISRLCEDKYKDWSRAAMRRSFSADN
FIGIQRSNAILS
Download sequence
Identical sequences F1PYE7
ENSCAFP00000019942 XP_545613.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]