SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_547580.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_547580.1.84170
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily EF-hand 2.18e-18
Family S100 proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_547580.1.84170
Sequence length 103
Comment PREDICTED: protein S100-A16 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MADSYTELEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLQKELNHMLTDTGNRKAAD
KLIQNLDANHDGRISFDEYWTLIGGITSPIANLIRQQEQQSSS
Download sequence
Identical sequences E2RP76 F2Z5M4 F7C5Z7 G3SQW7 L8HRD7 Q0VCM0
ENSLAFP00000002219 ENSBTAP00000018877 ENSCAFP00000025850 ENSSSCP00000007015 ENSECAP00000000463 ENSECAP00000000463 9615.ENSCAFP00000025850 9796.ENSECAP00000000463 9823.ENSSSCP00000007015 9913.ENSBTAP00000018877 ENSBTAP00000018877 ENSSSCP00000007015 ENSSSCP00000028458 ENSSSCP00000028919 ENSSSCP00000029665 ENSSSCP00000030447 ENSSSCP00000030665 NP_001068686.1.59421 NP_001068686.1.76553 NP_001177136.1.46622 NP_001177137.1.46622 XP_001494817.1.31192 XP_005203713.1.76553 XP_005203714.1.76553 XP_005203715.1.76553 XP_005610162.1.31192 XP_005622876.1.84170 XP_005663410.1.46622 XP_005910073.1.15283 XP_006040038.1.26621 XP_006041110.1.26621 XP_006041111.1.26621 XP_008541462.1.77740 XP_008541463.1.77740 XP_008541464.1.77740 XP_008565845.1.73410 XP_008565846.1.73410 XP_010593050.1.64505 XP_010836716.1.44457 XP_010836717.1.44457 XP_010836718.1.44457 XP_010836719.1.44457 XP_014338540.1.15283 XP_014338541.1.15283 XP_014720454.1.49734 XP_014720455.1.49734 XP_014720456.1.49734 XP_019810837.1.53367 XP_019810847.1.53367 XP_019810856.1.53367 XP_019810866.1.53367 XP_020944224.1.46622 XP_547580.1.84170 XP_866173.1.84170 ENSLAFP00000002219 ENSCAFP00000025850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]