SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_547945.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_547945.2.84170
Domain Number 1 Region: 871-1166
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.69e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000126
Further Details:      
 
Domain Number 2 Region: 215-359
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-35
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 9.81e-29
Family Second domain of FERM 0.00039
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-18
Family First domain of FERM 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_547945.2.84170
Sequence length 1170
Comment PREDICTED: tyrosine-protein phosphatase non-receptor type 21 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYHNKQNQRRWVDLEKPLKKQLDKYASEPTVYFGVVFYVPSVSQLQQEITRYQY
YLQLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKV
LEEATQKVALLHQKYRRLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEG
IFVKHKNGRPPVIFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVAR
HKFYRLNQCSLQTQTVTVNPLRRRSSSRVSLPKPQPYVMPPPPQLHYNGHYTEPYTSSQD
NLFATNQNGYYCHSLTSLDRAQIDLSGRIRNGSVYSAHSTNSLNNPQPYLQPSPVSSNPS
ITGSDVMRPDYVPSHRHSALVPPSYRPTPDYETVMKQLNRGMVHAERQSHSLRNLNIGNS
YAYSRPDALVYSQPEIREHAHLASPQSAHYPFSLNYSFHSPSPYPHPAERRPVVGAVSVP
ELTNVQLQAQDYPAPNIMRTQVYRPPPPYPPPRPANSTPDLSRHLYISSSNPDLITRRVH
HSVQTFQEASLPVAHSLQEVSEPLTAARRAHLHKRNSIEVAGLAHSLEGLRLKERTLSAS
AADPPPRPVSAGSQPGGFPERAERDQADERGGLAYGHKKSLSDATMLIHSSEDEEDLEED
VASLAVPLPQARAPRGRHSPEPPPPPPPGPSRGPGGPTPAALGQGALPGREPVPLLREAH
RPRREGLLTPSMSESDLTTSGRYRARRDSLKQRPVSDLLSGKKNVVEGLPPLGGMKKSRV
DAKKIGPLKLAALNGLSLSRLPLPDEGKEVPARATNDERCKILEQRLEQGMVFTEYEKIL
KKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKVSVSGIE
WDYIATQGPLQNTCQDFWQMVWEQGVAIIAMVTAEEEGGREKSFRYWPRLGSRHNTVTYG
RFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFLSYLEEI
QSVRRHTNSTSEPRSPNPPLLVHCSAGVGRTGVVILSEVMIACLEHNEVLDIPRVLDMLR
QQRMMMVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences E2RLF5
XP_547945.2.84170 ENSCAFP00000025608 ENSCAFP00000025608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]