SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_548132.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_548132.2.84170
Domain Number 1 Region: 570-709
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-45
Family Phosphotyrosine-binding domain (PTB) 0.0000173
Further Details:      
 
Domain Number 2 Region: 418-556
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-21
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_548132.2.84170
Sequence length 715
Comment PREDICTED: tensin-4 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MSQVMSSPLLAGGHAVGLTPCEEPRRALHPAPSPSLPPQCPYYTTEGWGAQALMAPTPYK
GPPSRCQQGPQPGAKASCLLQSPGEQASGTLEDLDSYIDFSLESLNQMILELDPTFQLLP
SGAGSPWAEPTKNTTSRIKKDEPEALDIKYIEVTSTRSRCHDGPQCCSSPSVTPPFGSPR
SGGLLLSRDIPRETRSSSESLIFSGSQGRGHQRPPPSSGAPSSHPSPSPSISIPCMGNKA
SGPQGLGSPLAVSPGLEKGLGGLAPQRGSRVSVLSASPASDVSYVFGSSQSLLHSSMSSH
QSSSRSLESPASSSSSLHSLGQVSLCTRASDFQAPSNPTPNMGQPRATHSSPLAKEHASS
CPPSITNSMVDIPIVLINGYPEPGSPPSQQILGRQDFVRPGATSSSNSCPATRSHSQTLP
DAPLTTSSEGPTRDMQPTMKFVMDTSKYWFKPSITREQAIELLRKEEPGAFVVRDSSSYR
GSFGLALKVQEAPAPSPNRSGEDNSDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQ
HSIMALALPCKLTIPQKELGGGDSSDPTTDSRASCLKKSAGCHALYLTSVSVESLSGALA
VRKAISTTFERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLATLRFCGMDPEQRK
WQKYCKPSWIFGFVAKSQTESQENVCHLFAEYDTVQPASQVISLVGTLLQDTERM
Download sequence
Identical sequences E2QX60
XP_548132.2.84170 ENSCAFP00000023638 ENSCAFP00000023638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]