SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_548447.2.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_548447.2.84170
Domain Number 1 Region: 204-321
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-24
Family SH2 domain 0.0007
Further Details:      
 
Domain Number 2 Region: 567-723
Classification Level Classification E-value
Superfamily Ras GEF 1.07e-21
Family Ras GEF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_548447.2.84170
Sequence length 859
Comment PREDICTED: SH2 domain-containing protein 3C isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MTEGPKKASRKFKFFKFKGLGSLSNLPRSFTLKRSSTSSSIESHLEPDTFEATQDDMVTV
PKSPPAYARSSDMYSHMGTMPRLSIKKARDPQATHKTKEVGLEPHLVAQGLPNPPGLEAA
KEVVVETKPPLEDTPAVGPNPSAMSPTEKPKDPRADRKEERDPRNVPPERVAGEPEAGGD
YVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLI
RDSLTSLGDYVLTCRWRNQALHFKINKVVVKAGESYTHIQYLFEQESFDHVPALVRYHVG
SRKAVSEQSGAIIYCPVNRTFPLRYLEACYGLGQGSSKAASPASPSGPKGGHMKRRSVTM
TDGLTADKVTRSSDGCPASTSLPHPRESIRNCALSMDQIPDLHSPMSPISESPSSPAYST
VTRVHATSAAPSATALPASPVTRRSSEPQLCPGSTPKPPGESDKGPYASPSHTLCKASPS
PSLSSYSDPDSGHYCQLQPPVRGSREWAMAEASGRQARSYGERLKELSENGASEGDWGRA
FTAPVVEATSSFNPATFQSLLIPKDNRPLEVGLLRKVKELLAEVDARTLARHVTKVDCLV
ARILGVTKEMQTLMGVRWGMELLTLPHGRQLRLDLLERFHTMSIMLAVDILGCTGSAEER
AALLHKTIQLAAELRGTMGNMFSFAAVMGALDMAQIARLEQTWVTLRQRYTEGAILYEKK
LKPFLKSLNEGKEGPPLSNTTFPHVLPLITLLECDSAPAEGPEPWGSTEHGVEVVLAHLE
AARTVAHHGGLYHTNAEVKLQGFQARPELLEVFSTEFQMRLLWGSQGASSNQARRYEKFD
KVLTALSHKLEPAVRSSEL
Download sequence
Identical sequences E2RRA8
ENSCAFP00000029815 XP_548447.2.84170 9615.ENSCAFP00000029815 ENSCAFP00000029815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]