SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_558841.1.40869 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_558841.1.40869
Domain Number 1 Region: 176-477
Classification Level Classification E-value
Superfamily BEACH domain 2.35e-126
Family BEACH domain 0.00000000657
Further Details:      
 
Domain Number 2 Region: 532-671,702-875
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.04e-32
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 78-175
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-21
Family PreBEACH PH-like domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_558841.1.40869
Sequence length 885
Comment AGAP003389-PA [Anopheles gambiae str. PEST]; AA=GCF_000005575.2; RF=representative genome; TAX=180454; STAX=7165; NAME=Anopheles gambiae str. PEST; strain=PEST; AL=Chromosome; RT=Major
Sequence
MRLKLEPDLYHDPHTAAVNMRDNTTSSTSQSRRLSSEFGSTFAPAAIGEENTDDEMLLLE
EEMRNSLEAQVPETSGREKIVITQECELITLMTRVKGRFDLTTNQLMFTEIASLKDDGQR
HDFKFPIGQLRELHLRKFNLRRSALEMFLTDQTSYFLNFTTRTRNKIFTKILSLQPPNIL
YGSGRSPAELLKSSGLTQKWANREISNFEYLMHLNTIAGRSYNDLSQYPVFPWILADYTS
EVLDLNDPRSFRDLSKPIGVVNPKNEAEVRSKFDGFEDPSGMIPKFHYGTHYSNSAGVLH
YLIRVEPFTSLHIELQSGRFDVADRQFHSIPQTWKLLMDNPNDVKELIPEFFYFPEFLKN
MNRFDLGVLQMTKEKVDDVVLPPWAKTAEDFIAIHRRALESEYVSQHLHHWIDLIFGYKQ
KGPKAVDALNVFYYCSYEGAVDLDKIANPIEREAVEGMINNFGQTPSQLLRDPHPRRLSL
DELTIRLLKLELRRPDLTLILDRVQCTACDLSTDKDPVVYLSTPKSPPRSFLQTSPDMLI
TVTKSGILGCHSWMSFDKERGFLLEIDATTLNLKNRKKLTGPFHPSITLSSKLFALSVDA
KYIYAGGIWDNSVRVFNMARGKVVASAINHFDVVTCIAMDNCGSYLVTGSKDCTCVIWSL
STSNSVSQPAGSNLQPNTAALNQNLAGNVVGSANVVHLTNNLTPKPVHTLYGHDDAVSCV
AIMTELDMVVSGSLDGTVNVHTIKNGQFIRTINPIGCTGCKIEVSFITISYQGHIAFSAL
DDTSHSVHVFSINGVSLGSKYVSGRVTGLTSSSDYLVVSDDAGDVTMSRLYGLKPIFDIP
LHVPTQTVVGTVGNTHLLAPLRDGSLGVIGIQQPIPYKKHTVLNV
Download sequence
Identical sequences Q5TUA8
AGAP003389-PA|hypothetical AGAP003389-PA XP_558841.1.40869 7165.AGAP003389-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]