SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_566535.1.95466 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_566535.1.95466
Domain Number 1 Region: 110-263,368-398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-20
Family SPRY domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_566535.1.95466
Sequence length 618
Comment transcription regulator [Cryptococcus neoformans var. neoformans JEC21]; AA=GCF_000091045.1; RF=representative genome; TAX=214684; STAX=5207; NAME=Cryptococcus neoformans var. neoformans JEC21; strain=JEC21; AL=Chromosome; RT=Major
Sequence
MSLENRLSPPLSRSETPALGTVGTVLDNATASLPLPNQNFPGEGLAGPGPSTTENHTKKV
IREDVERRQYARMGTIMPGTGDGLGIGEECFSWTDIPNVKNFRYHPCALSPTPSPHPVFP
FYRTIPYPPPIPPVHLSLLDRSSYLRISPSLLTIYNDRGFRSCRTNVSVREGTWYYEVHI
DRGDGEQGARRGAGGEGGNPHVRLGWGRREANLDTPVGCDAYSYAIRDVGGEKVHISRPK
PYANKGFRTGDIVGCLISLPRRPSLEDKPVSDPARIKRQRRAFNYKSQAYFESAEYTPSK
EMDALIDRDGKLAAAAKVESQAQEINGGDMPKKQMGATTKNTKKGKKQPEKAHEPVARKL
EKLSSSSISFFINGESFGEAFTDLYDFTPLPSLYPPVGGHGKKHHPGDEVLHDDGTLGYY
PMVSCFGRAKATCNFGPDFAHPLPEGARPMCERYAEFKEEERLLDEKDEVEDAERLRQIL
EAEKKMLSKVKPRNQKANSATASGENTPKRKKGPAPKRKREGRDGTEMSTPGVESVRGLT
ATPAPEAPMSEAGIEWREGTRERSMSVAASLGGQGWGTVKEEISDEREEKKIKKDKEVEV
KQENGGNSEDGEFEGINW
Download sequence
Identical sequences F5HCU1 Q5KPZ4
sgtc|cn01104 181.m08702 XP_566535.1.95466 XP_778097.1.65578 214684.CNA01030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]