SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_569667.1.95466 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_569667.1.95466
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.06e-33
Family Thioltransferase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_569667.1.95466
Sequence length 104
Comment thioredoxin (allergen cop c 2) [Cryptococcus neoformans var. neoformans JEC21]; AA=GCF_000091045.1; RF=representative genome; TAX=214684; STAX=5207; NAME=Cryptococcus neoformans var. neoformans JEC21; strain=JEC21; AL=Chromosome; RT=Major
Sequence
MVKAIESYDEWKTLTSGSDVVVVDYWATWCGPCKMISPHFAKLEGKFPNVKFAKVDVEEQ
EDIAKEAQIKAMPTFVAYKDGKVIETVTGAVPAKINALLDKVAA
Download sequence
Identical sequences A0A225ZK74 A0A226BN91 F5HC20 J9VKF2 Q5KK55
sgtc|cn03304 179.m00363 XP_012048143.1.45702 XP_012048144.1.45702 XP_569667.1.95466 XP_776808.1.65578 214684.CNC04200 CNAG_02801T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]