SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_572295.1.95466 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_572295.1.95466
Domain Number 1 Region: 12-93
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.93e-20
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_572295.1.95466
Sequence length 100
Comment NADH dehydrogenase 10.5K chain [Cryptococcus neoformans var. neoformans JEC21]; AA=GCF_000091045.1; RF=representative genome; TAX=214684; STAX=5207; NAME=Cryptococcus neoformans var. neoformans JEC21; strain=JEC21; AL=Chromosome; RT=Major
Sequence
MSSFAKQIPKAVKEIRLHFCQTSAASAGVRQFVQSSYPAVKSANPDLKFLIREASNISPR
AFVRFERGVESEAQLANLSEPDVGKVLTHLVNQQSGAGVA
Download sequence
Identical sequences A0A095CGT7 A0A0D0V4X5 A0A0D0XDA3 A0A225XA78 A0A226B961 F5HF66 J9VWL5 Q5KCH4
XP_012053768.1.45702 XP_572295.1.95466 XP_772481.1.65578 sgtc|cn12099 214684.CNH01030 CNAG_05434T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]