SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_572916.1.95466 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_572916.1.95466
Domain Number 1 Region: 37-260
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.13e-62
Family Lectin leg-like 0.0000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_572916.1.95466
Sequence length 367
Comment lectin [Cryptococcus neoformans var. neoformans JEC21]; AA=GCF_000091045.1; RF=representative genome; TAX=214684; STAX=5207; NAME=Cryptococcus neoformans var. neoformans JEC21; strain=JEC21; AL=Chromosome; RT=Major
Sequence
MRRNPTLSLLSLTALTAISGVNAAESEDSLASVIERTVPLRTHSLAAPYVDTDLQNRWWD
FGGDTIINTNKHVRLTQDKPSQSGWLWARMPLSVSNWQIDVEFKVDGKAHNIFGDGWAFW
LTSDRAKQGPVFGSVDWFKGIGIFFDTYANSKHAYTFPRVSAMLGDGKTSYDHDRDNEAN
EIGGCSENFRRRGDVPTKARLTYVKGRALQLKLQTKKSDEWKICFETNVDLPESPYIGFS
AATGDVSDDHDIVAVNTYSLTLKPEYRASKSSSDSKSKSKSDGKQAAMNANTNGMSGKGR
KEVKSGGTGWFMFILKVIGVLAFIAFAVAAFVSSLVIVFSFSIPLLWNLPTPTARFLVVN
QWKINTN
Download sequence
Identical sequences 214684.CNI04370 XP_572916.1.95466 162.m03607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]