SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_581568.3.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_581568.3.59421
Domain Number 1 Region: 24-168
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-31
Family Dual specificity phosphatase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_581568.3.59421
Sequence length 345
Comment PREDICTED: dual specificity protein phosphatase 12 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MLEAQEGSHGWEHQIGSQSRASSARHMLEVRPGLFLGGAAAVAEPDHLREAAVTAVLTVD
SEEPNFKTGAGVEGLRSLFVPALDKPETDLLSHLDRCVAFIVQARAEGRAVLVHCHSGVS
RSVTVITAFMMKTDQLTFEEAYENLKTVKPEAKMNEGFEWQLKLYQAMGCEVDTSSAVYK
QYRLQKVTEKYPELQNLPQELFAVDPSAISQGLKDGGLYKCRKCRRSLFRSSSVLDHNEG
SGPIAFAHKRMTASPMLSAGSQAQCTSYFIEPVQWMESTLLGVMDGQLLCPKCNAKLGSF
NWYGEQCSCGRWIAPAFQIHKSRVDETKTLPMWGSQTRETGTRYM
Download sequence
Identical sequences F1MW70
ENSBTAP00000028997 ENSBTAP00000028997 XP_002685893.1.76553 XP_581568.3.59421 9913.ENSBTAP00000028997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]