SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_628009.1.25317 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_628009.1.25317
Domain Number 1 Region: 425-491
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000465
Family PHD domain 0.016
Further Details:      
 
Weak hits

Sequence:  XP_628009.1.25317
Domain Number - Region: 499-560
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000162
Family PWWP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_628009.1.25317
Sequence length 660
Comment PHD finger containing protein [Cryptosporidium parvum Iowa II]; AA=GCF_000165345.1; RF=representative genome; TAX=353152; STAX=5807; NAME=Cryptosporidium parvum Iowa II; AL=Chromosome; RT=Major
Sequence
MFINILNTSQNNKETVADIRTINEVEKDFLGNSIFQGCTQTSDYIFNTQEKFNSNLLEKA
NNSNDYNNHNNSASPVDELGNQNCISLEALKGKMSQDVTFDSDFKNKSKNNLDLNWQEGK
VSIKKGKIKVECNYAFTPTKSSLRVRCIYCKKIYFSVKGFISHRGRCIYYKAFQNTQYES
ISQNCKNSNSNKYLSNSKEKSLQNNQILNSLVDTQYTENSQYNSKINSGFQSSTNEDTTL
FNYNSDNRFHFDDKEMDHLSTYNTLRKVINGNNHIFELEKSSNLNSNKSESSKNSNGKIE
NTSFYNDKIDVENFKMYLYAAISCLPKYIVAKILKRRNPGISISIDEKSEDITKEELIDM
IFAGIGQKVLQNNSDLKGETNEKLLEQKNLLNNLRCDKTEKIELELESIKSESNSINNDI
KDENFQLNIPVFFRHSLPKDSEWKCYICKVPRNGKESMNMCVNCGYIYHLTCQSQANKIT
KNDWFCDYCKAHGNKLKPGSKFQIGELVWVNYKCTFWPAQIMEFSKEQFEVFIFHIEKRI
EKSSNEILPWSKGIISIDGLASKGTFVRESTSSIMHWQSVYKAIKYYLNSLRSKQRRLPQ
IKKKNSSNEFKIDNKKKKTDVMVSNNSNSETRVFHPIPSGINDGLEQHSNEISLLDVSSH
Download sequence
Identical sequences Q5CSQ8
XP_628009.1.25317 gb|cgd1_1690 5807.cgd1_1690 gi|46227492|gb|EAK88427.1| gi|66362090|ref|XP_628009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]