SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_646625.1.73096 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_646625.1.73096
Domain Number 1 Region: 440-821
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.25e-91
Family Ankyrin repeat 0.00000279
Further Details:      
 
Domain Number 2 Region: 29-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.2e-34
Family Calponin-homology domain, CH-domain 0.00048
Further Details:      
 
Domain Number 3 Region: 364-477
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.56e-24
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_646625.1.73096
Sequence length 839
Comment hypothetical protein DDB_G0270220 [Dictyostelium discoideum AX4]; AA=GCF_000004695.1; RF=representative genome; TAX=44689; STAX=44689; NAME=Dictyostelium discoideum; strain=AX4; AL=Chromosome; RT=Major
Sequence
MSTNNLGRPVRPTGSKKTGGASSVTITMSDFQTYEMQARQVECKLWIESIIDEEIDNDLH
QALKDGVVLCKLANTMFPAIITRYNKQSSITFKLLENINSFLQVAKKMGISDNQLFIATD
LWENKNFQMVISTINKMATIAVSKGFPIKWPTVDDPNKETKFEKASPDRVLEWDNSFIYS
NNSSNSNNGNNSPKSPASTIGKKTTSFGTPTTSRNSINFSLPPKLTASSTSTSNLIQTNS
NPTTPTTSTTSTPNLSSTVTITTTTPTTTPTPTPTKPITPLVVTPPATVVSPLSPISLVS
TPPPPTTTTIVVKENENEKEKEQLPPPQSQSQPQPKIEKENENEKIKTNLETEILIKKEL
TKQDKIEIIINQYKELSIKENNGNESIHYAVRDGNIEVIKSIANSDNVNSKNQNTGRTPL
HVGVLNGNVEIVEILLEIEGCDCNQADTDGNTPIHLAVLKGNHSMVETLIKKGTQTNTNA
VNRDGSTPMMMVSVNGDERMVDLLLEGGADVNSSNKKGNTALHYATLKGHKKVVDKLLEA
GSDVNAVNQDGATSLHVAAEENFPNIIESLANSGAVVDQQRLDGWTPLYSAAFKGNRETA
ISLLSKGASVDSHNLEGWTPLHSACSEGHLKMAQLLITTYKSDVNSQNFQGTTSLFHACS
SGHLELVKYLFQVGSNPELSRPGGWKPIHIACYNENDLITRYLIEKNVNLNCTNSEIKGY
APIHILISTEEPRLEIIELLLSKKINVNIKNVNGSTPLHLAVFWNHFKVLELLLKYGASL
EEKNNKGRTPLSLACHYGNEIIAKYLAEKTNKDVKKLKIKNNKQKILDMEIPDSPPVPL
Download sequence
Identical sequences Q55C56
DDB0306623|DDB_G0270220 XP_646625.1.73096 44689.DDBDRAFT_0190886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]