SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_647459.1.73096 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_647459.1.73096
Domain Number 1 Region: 32-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-31
Family Calponin-homology domain, CH-domain 0.00036
Further Details:      
 
Weak hits

Sequence:  XP_647459.1.73096
Domain Number - Region: 825-883
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.0408
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_647459.1.73096
Sequence length 954
Comment hypothetical protein DDB_G0267974 [Dictyostelium discoideum AX4]; AA=GCF_000004695.1; RF=representative genome; TAX=44689; STAX=44689; NAME=Dictyostelium discoideum; strain=AX4; AL=Chromosome; RT=Major
Sequence
MASVAQGTYGNAVFRGDGVRLYGLDAELELKAQAKRDPQTEIELIKWIEKVIGEKLKFPD
DLIESLRSGIVLCKLLNSLIPGTIKNINTARDTALHHMENIGLYLKACWIVGIQSSDLFV
SSDLYLRKNINAVIQNLLAIARATHTLENYKGPTFGYKPNTNIQPAKKWDQIVYKGPTYV
TDLENTTTNQNNNIDCTKCGIEKVCIKCNPPPTPTIPTTTTTTTNVNSILNEKEREREKE
KEKELLLKIQNLSNALKEKEEGLKLLNENLEKQRKKNLEEEKEFKNLIETQKVQLASKDS
IISSINKTNSNLILLTSNNNNNNNNNNNNNNNNNSAPPSVSGINIQSTSTVSSNSTQPTS
SSSSFINKSNRNSGVFQTIASYNNKSGASSTLAIPSSSASNTSPGTILSKCTRCNITTTK
TIKYCSSCGELLVKENSSTPNTSTFNKPPITSRSSITITSPPSNNNTTTTTVTTPPLPTA
TASPPLVSISTTTTMNENEKIKTLIATMKQQEEVIAKLNQQIKVDKEIFEKEKKQQKQTI
DNQQFLLNQKDQDLKKARESSTSSSSSSSSTSIKKGEFLLSAELKSANSNTSSESYSSFS
RPIGNNSTNTTTITNKELESLREKVKSLEIKLNEEICKTKAKDSQITLLNEKIQSINSRP
KRVVASNQVVSASGGGNNRNSQQVIVGRKRFNTLKPDAVDLTTLVDATLVHLATILYSKP
IEFYQVNSLKDLFNSELGRRRFSQILKMTLKKVPSLQMNESSFEFLLFLISCALQEMNLS
KDNDIEAAKILFNSSDLLYRINPKTGQSEFLKDYIRSANIFKESAFWSEYYWSELSKRHR
KIYGNIPDTLDKEIVNNLLAYFGQNMIYFSVSSDQVKNFITEIAQQHNLPNSQIDLIIAS
IKDSPLYTSTKSTSNTNNSNTNNNNNNNGNVVSSAKVVSKKDREKDKDKKKKIN
Download sequence
Identical sequences Q55FS4
44689.DDBDRAFT_0189688 DDB0306513|DDB_G0267974 XP_647459.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]