SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_648475.2.49425 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_648475.2.49425
Domain Number 1 Region: 594-729
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000000532
Family Ricin B-like 0.013
Further Details:      
 
Domain Number 2 Region: 764-810
Classification Level Classification E-value
Superfamily RPA2825-like 0.0000589
Family RPA2825-like 0.0076
Further Details:      
 
Weak hits

Sequence:  XP_648475.2.49425
Domain Number - Region: 518-573
Classification Level Classification E-value
Superfamily MTH1598-like 0.0497
Family MTH1598-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_648475.2.49425
Sequence length 816
Comment hypothetical protein [Entamoeba histolytica HM-1:IMSS]; AA=GCF_000208925.1; RF=representative genome; TAX=294381; STAX=5759; NAME=Entamoeba histolytica HM-1:IMSS; strain=HM-1:IMSS; AL=Scaffold; RT=Major
Sequence
MHSQNISLFKDINDISKGLSDQFRNIISKCTKPHFICICGDQYIDENTNIHQIINGISSN
DYLNAQESLKSSNKISTSESNNCNVIGPILVSDIVKRNNLEEQEFQQILNDELFFIEIEK
HKLTSSTTPNNIVEILSILQLSSIRIIYNNNEINAGILEDISSFDYPSCLLELQGIRKEG
KRVICISPDIQTITEKENETILKESVLNKQKHINNDLVHFFSTKSHQTNCLCFLLPSYSH
PSPSQIVCNIYKEQMKCIISEILHEIPLNCKSGSYVLSCIELLIELFKSINELNINTISN
EIQRLFKKKYVETISSINIKLVGMIYEMNLNERINVIENQSKIKSRVYQIIENEFIPIWD
ILHIIYGNQLINELFDSISITSKHLEEFILKEIQKIIDDLIHCNDFRLTPMWKYLTQLQI
KEQFEQENYNTIINNYLAQTLTSNQKILQFYSNKKCTTVNEVKHQCIDTITLKTNEILNG
KQQWRDVYITVKNYYHNLINTIDKEVQTKELSTVRQVELCHQYYLGLFTSKSETYTTQHE
QIIFNKNDYNDILQDALNELNALFDKKKQIAQSLEQTHLKEELEQKKEAFIKKLTSKSYY
IMPCCTTRYVLDAKYSDFTDGQPITLYWSHGNQNQSFQFIQKNNLFQIKIGHNGFLVHRN
DSSEGSVIHQWNDTTSINSLWKIIENHDGTISFLSASNESLAFTADSNELISLCHTCYFT
CSDYQKFKLLESPLNNQPIPLPPTNQETPNHQTQFFQIPKYVGPSIVEALNNIHVDSSFS
YRERIAQVNNIQEYHGSAYQNDYMRKLLYQGRLIKP
Download sequence
Identical sequences A0A175JG68 C4LUZ5
XP_648475.2.49425 jCVI|EHI_092310 294381.C4LUZ5 gi|169802878|gb|EAL43085.2| gi|183230509|ref|XP_648475.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]