SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_649445.1.49425 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_649445.1.49425
Domain Number 1 Region: 14-240
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.37e-73
Family Inorganic pyrophosphatase 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_649445.1.49425
Sequence length 244
Comment inorganic pyrophosphatase [Entamoeba histolytica HM-1:IMSS]; AA=GCF_000208925.1; RF=representative genome; TAX=294381; STAX=5759; NAME=Entamoeba histolytica HM-1:IMSS; strain=HM-1:IMSS; AL=Scaffold; RT=Major
Sequence
MSITSIVPNFGTIRTEPVGTLGKKDYRIYFEQEGKKISPWHKIPAFVSKDVVNMVCEIPR
GTNAKMEISTTNKFNPIKQDLNKDGSLRYMKHGNVLNHYGAVPQTWEDLFERDSIVGIPG
DNDPIDIIDISQKKVARGEIVQIKPICALALLDGGETDWKVIGINVNDPLAQTITSANDI
EKTVDEIREWYRVYKVAEGKKLNKYAYGGKAFNQKSTLDIINETHLQYRKLKTTQKKLSK
LALD
Download sequence
Identical sequences A0A175JXM0 C4M982 M2Q2R6 M3SAR5 M7W242 N9V599
gi|56465887|gb|EAL44058.1| gi|67466595|ref|XP_649445.1| 294381.C4M982 jCVI|EHI_124880 EnhiA.00229.a XP_649445.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]