SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_649631.1.49425 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_649631.1.49425
Domain Number - Region: 84-135
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000903
Family Tudor domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_649631.1.49425
Sequence length 218
Comment hypothetical protein [Entamoeba histolytica HM-1:IMSS]; AA=GCF_000208925.1; RF=representative genome; TAX=294381; STAX=5759; NAME=Entamoeba histolytica HM-1:IMSS; strain=HM-1:IMSS; AL=Scaffold; RT=Major
Sequence
MEQIEQLENAITQQELDLKDLNELLVEDSTNEEILSLKKEAETTLNTLKKQLEQYRLTIL
SSKEELKLTNNSSSNNTNETKTIYFKPNDQVIAWSQRDNGWFAAMITRPSNNQMYWVRFG
PRDNQLVSLDKIKPFSDINSVQLSSINTSKIKIRKLPKKTITELPKWTKPKPNDTEKDLL
LKRKKRHQLKSLMKQQKEEEDLETKKNSWKAFASKMKK
Download sequence
Identical sequences A0A175JXM4 C4M9V1 K2GCS9 M2RIS4 M3TZZ7 M7WF87 N9V434
jCVI|EHI_036840 294381.C4M9V1 gi|56466113|gb|EAL44245.1| gi|67467022|ref|XP_649631.1| XP_008857310.1.50645 XP_649631.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]