SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_656496.1.49425 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_656496.1.49425
Domain Number 1 Region: 115-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-86
Family Protein kinases, catalytic subunit 0.000000342
Further Details:      
 
Domain Number 2 Region: 3-93
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-27
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_656496.1.49425
Sequence length 441
Comment PH-protein kinase domain containing protein [Entamoeba histolytica HM-1:IMSS]; AA=GCF_000208925.1; RF=representative genome; TAX=294381; STAX=5759; NAME=Entamoeba histolytica HM-1:IMSS; strain=HM-1:IMSS; AL=Scaffold; RT=Major
Sequence
MPKEGWLAKQGGGWKNWKHRWFVLDGTTLTYYKDQLRMKKMGEIDLMLAFAIVPNEELKL
KNFPYIFSISTPSRVYNISASSSKERDEWIESLLNSKNKKETLIEKEEEEKPISIEDFDI
ITLLGKGAFGKVLLVRYKRTGEKFALKMVEKKKVIEMEELEHTMTEKNILQKVKHPFLVN
LYYSFQSATHLHYVIDYCPGGELYYRLIQEKSFCESRTQFYISQVILALECLHQMNIIYR
DVKLENVLICEDGYLRLTDFGLSKENVSGNETTATFCGTPEYLSPEVVLAEPYTNVIDWW
GVGIMTYEMMHGQAPFISDNIQQLYQKILYSPVIFPTTSPVSAVCKDFITKMLEKKICDR
LSTPEKIKTHPWWNSFDWDALYQKKIPAPFKPDMSQDGKTNFGEEFINEKFDLNEEINNS
TSNGIRQDIFGEFTFTRDEPK
Download sequence
Identical sequences A0A175JH74 C4LVW8 M2R608 M3U3G8 M7X2U3 N9UKV1
294381.C4LVW8 gi|56473687|gb|EAL51099.1| gi|67482293|ref|XP_656496.1| XP_656496.1.49425 jCVI|EHI_125820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]